Welcome to Tajirgah
English Language
Azerbaijan AzerbaijanArabic ArabicRussia Russia
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz
New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz
New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz
New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz
New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz
New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz
New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz

New Automatic Self Stirring Magnetic Mug Creative Stainless Steel Coffee Milk Mixing Cup Blender Laz

Product Code: r3aDRc2
Product Condition: New
$25.68 inc. tax
 Add to Cart
Description







 
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Register to earn Loyalty Points points
Loyalty Program
Join our VIP rewards program today!
Register to earn Loyalty Points
Points mean prizes!
Ways to earn
see more..
Ways to redeem
see more..
Join today
Already have an account?Sign in